PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vun002668
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family HD-ZIP
Protein Properties Length: 291aa    MW: 33359.3 Da    PI: 4.5776
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-167a-Vigna_unguiculata-13752PU_refplantGDBView CDS
gnl|UG|Vun#S45935963PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.41.6e-2066119356
                --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                k++++++eq++ Le+ Fe+++++  e++++LAkklgL+ rqV vWFqNrRa++k
  Vun002668  66 KKHRLSSEQVHLLEKSFEEENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWK 119
                67889************************************************9 PP

2HD-ZIP_I/II133.86.2e-4365156192
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  ekk+rls+eqv+lLE+sFeee+kLeperK++la++LglqprqvavWFqnrRAR+ktkqlE+d+++Lk++yd+l ++ ++L ke+e+L++e+ 
    Vun002668  65 EKKHRLSSEQVHLLEKSFEEENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKTKQLERDFDVLKSSYDTLLASYDSLMKENEKLKSEVV 156
                  69**************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.56E-2053123IPR009057Homeodomain-like
PROSITE profilePS5007118.18861121IPR001356Homeobox domain
SMARTSM003895.3E-1963125IPR001356Homeobox domain
CDDcd000861.86E-1866122No hitNo description
PfamPF000469.0E-1866119IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.1E-2267128IPR009057Homeodomain-like
PRINTSPR000314.5E-692101IPR000047Helix-turn-helix motif
PROSITE patternPS00027096119IPR017970Homeobox, conserved site
PRINTSPR000314.5E-6101117IPR000047Helix-turn-helix motif
PfamPF021835.0E-18121163IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MESGRLFFDA CASRGNTNML FLGNTELAFR GRSMMSLEEA SKRRPFFTSP DELYDEEYYE  60
KQMPEKKHRL SSEQVHLLEK SFEEENKLEP ERKTQLAKKL GLQPRQVAVW FQNRRARWKT  120
KQLERDFDVL KSSYDTLLAS YDSLMKENEK LKSEVVSLNE KLQVQAKEVP EEPLYDKKVD  180
PLPVEDIASI FSTRVEDHQS SGSVGSAVVD EGSPQLVVDS VDSHFPADNP GGCVGPVERV  240
QSEEEDGSDD GRSYMDVFVV SETENQNHEK RGIGLVDQYV LCWIMIMQQQ T
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1113121RRARWKTKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014515876.10.0PREDICTED: homeobox-leucine zipper protein HAT5
SwissprotQ022838e-92HAT5_ARATH; Homeobox-leucine zipper protein HAT5
TrEMBLA0A0S3T7800.0A0A0S3T780_PHAAN; Uncharacterized protein
STRINGGLYMA13G23890.31e-176(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.15e-93homeobox 1